PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G10590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 253aa    MW: 26157.2 Da    PI: 5.5564
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G10590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB158.41.1e-4926120195
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdr++Pianv+rim++vlP +akis+dake++qecvsefisf+t+ea+d+c+re+rkt++++dl+wa+  lGf+dyv pl+vyl++ re e
  OPUNC06G10590.1  26 VREQDRLMPIANVIRIMRRVLPPHAKISDDAKEVIQECVSEFISFITGEANDRCHREHRKTVTAEDLVWAMDRLGFDDYVPPLTVYLRRMREYE 119
                      69******************************************************************************************99 PP

            NF-YB  95 g 95 
                      g
  OPUNC06G10590.1 120 G 120
                      7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.8E-4621121IPR009072Histone-fold
SuperFamilySSF471131.86E-3629125IPR009072Histone-fold
PfamPF008082.3E-243396IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.9E-136078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.9E-137997No hitNo description
PRINTSPR006154.9E-1398116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MEPAFPNGGA AAAAPAMAAE QPATAVREQD RLMPIANVIR IMRRVLPPHA KISDDAKEVI  60
QECVSEFISF ITGEANDRCH REHRKTVTAE DLVWAMDRLG FDDYVPPLTV YLRRMREYEG  120
GGSGGGGGGR GAATPVVRGG DRAAPPPPPE DAFRYVQVHH PVYAAPGEPV QGYYPVAISS  180
VLPAGGAPAP HVHVGGGGGG GQHEVFGGEP APMAVYYGGA PYGEASSRGG CSAADEGSSS  240
SSASPAPVGP SYQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-3825117193NF-YB
4awl_B8e-3825117294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-3825117294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880350.0AB288035.1 Oryza sativa Japonica Group OsHAP3D mRNA for HAP3 subunit of HAP complex, complete cds.
GenBankAK1096600.0AK109660.1 Oryza sativa Japonica Group cDNA clone:002-141-E08, full insert sequence.
GenBankAP0047910.0AP004791.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0491D10.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAY0621830.0AY062183.1 Oryza sativa HAP3 transcriptional-activator (LEC1A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642670.11e-112PREDICTED: nuclear transcription factor Y subunit B-9
TrEMBLA0A0E0LAH70.0A0A0E0LAH7_ORYPU; Uncharacterized protein
STRINGLOC_Os06g17480.11e-112(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-52nuclear factor Y, subunit B6